Recombinant Human Agpat4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Agpat4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-378 of Human AGPAT4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AGPAT4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Agpat4 Protein

  • 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta)
  • 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4
  • dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta
  • EC 2.3.1.51
  • LPAAT-delta1-AGPAT4
  • Lysophosphatidic acid acyltransferase delta
  • lysophosphatidic acid acyltransferase-delta (LPAAT-delta)

Background

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74276
Species: Hu
Applications: WB
NBP2-01664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010555-D01P
Species: Hu
Applications: WB, ELISA
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
H00009056-B01P
Species: Hu, Rt
Applications: WB
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-76907
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Agpat4 Recombinant Protein (H00056895-P01) (0)

There are no publications for Agpat4 Recombinant Protein (H00056895-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Agpat4 Recombinant Protein (H00056895-P01) (0)

There are no reviews for Agpat4 Recombinant Protein (H00056895-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Agpat4 Recombinant Protein (H00056895-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Agpat4 Products

Bioinformatics Tool for Agpat4 Recombinant Protein (H00056895-P01)

Discover related pathways, diseases and genes to Agpat4 Recombinant Protein (H00056895-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Agpat4 Recombinant Protein (H00056895-P01)

Discover more about diseases related to Agpat4 Recombinant Protein (H00056895-P01).
 

Pathways for Agpat4 Recombinant Protein (H00056895-P01)

View related products by pathway.

Blogs on Agpat4

There are no specific blogs for Agpat4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Agpat4 Antibody
NBP2-30948

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Agpat4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT4