![Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining in human kidney and lymph node tissues.. Corresponding AGMAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Immunohistochemistry-Paraffin-NBP1-82080-img0010.jpg "Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining in human kidney and lymph node tissues.. Corresponding AGMAT RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGMAT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82080 | Applications | Species |
|---|---|---|
| Mossmann D, Müller C, Park S et al. Arginine reprograms metabolism in liver cancer via RBM39 Cell 2023-09-26 [PMID: 37804830] (WB, Mouse, Human) | WB | Mouse, Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for AGMAT Antibody (NBP1-82080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: AGMAT Antibody [NBP1-82080] - Analysis in human cell lines Caco-2 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Western-Blot-NBP1-82080-img0006.jpg "Western Blot: AGMAT Antibody [NBP1-82080] - Analysis in human cell lines Caco-2 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Western Blot: AGMAT Antibody [NBP1-82080] - Analysis in control (vector only transfected HEK293T lysate) and AGMAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/AGMAT-Antibody-Western-Blot-NBP1-82080-img0014.jpg "Western Blot: AGMAT Antibody [NBP1-82080] - Analysis in control (vector only transfected HEK293T lysate) and AGMAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Immunohistochemistry-Paraffin-NBP1-82080-img0013.jpg "Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human lymph node shows very weak cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Immunohistochemistry-Paraffin-NBP1-82080-img0009.jpg "Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human lymph node shows very weak cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Immunohistochemistry-Paraffin-NBP1-82080-img0011.jpg "Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/AGMAT-Antibody-Immunohistochemistry-Paraffin-NBP1-82080-img0012.jpg "Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Western Blot Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Western_Blot_11080.jpg)
![Simple Western Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Simple_Western_17620.jpg)
![Knockout Validated Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images/af4376_human-mouse-rat-transglutaminase-2-tgm2-aff-purified-pab-20820241518569.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9968.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9969.jpg)
![Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af660_human-ctgf-ccn2-c-terminus-affinity-purified-polyclonal-ab-822024951141.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")