AGAP2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AGAP2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGAP2
  
  

  Source: E. coli

  Amino Acid Sequence: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AGAP2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16972.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AGAP2 Recombinant Protein Antigen

• AGAP-2
• ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
• arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
• centaurin, gamma 1
• Centaurin-gamma-1
• CENTG1
• cnt-g1
• FLJ16430
• GGAP2
• GTP-binding and GTPase activating protein 2
• GTP-binding and GTPase-activating protein 2
• KIAA0167
• Phosphatidylinositol-3-kinase enhancer
• phosphoinositide 3-kinase enhancer
• PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2

Background

AGAP2 (also known as centaurin-gamma1, ARF-GAP with GTP-binding protein-like, ankyrin repeat and pleckstrin homology domains 2, Phosphatidyl-inositol-3-kinase enhancer, PIKE, GTP-binding and GTPase activating protein 2 and GGAP2) is a GTPase activating protein that inactivates Arf. The expression of AGAP2 is amplified in human glioblastoma cells. AGAP2 protein binds to and activates the protein kinase Akt and prevents apoptosis of cancer cells. AGAP2 also increases motility and invasive activity of cancer cells. AGAP2 may serve as a diagnostic and therapeutic target of human cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: AGAP2