AFAP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: AFAP Antibody [NBP1-90216] - Immunofluorescence analysis of alpha-smooth muscle actin (a-SMA) and actin filament-associated protein 1 (AFAP) under hypoxia for 12 h; DAPI (blue), vimentin (green, upper), a-SMA (green, lower), a-tubulin (red, upper), AFAP (red, lower). Results are representative of three independent experiments, scale bar = 50 uM. Image collected and cropped by CiteAb from the following publication (mdpi.com/1422-0067/20/10/2546), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: AFAP Antibody [NBP1-90216] - Staining in human colon and liver tissues using anti-AFAP1 antibody. Corresponding AFAP1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: AFAP Antibody [NBP1-90216] - Staining of human cell line U-251 MG shows positivity in cytoplasm, actin filaments and focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AFAP Antibody [NBP1-90216] - Staining of human colon shows high expression.

Immunohistochemistry-Paraffin: AFAP Antibody [NBP1-90216] - Staining of human liver shows low expression as expected.

Immunocytochemistry/ Immunofluorescence: AFAP Antibody [NBP1-90216] - Effect of an ERK-specific inhibitor (SCH 772984) on phenotypic markers of EMT under hypoxia; DAPI (blue), vimentin (green, upper), alpha -SMA (green, lower), AFAP (red, upper), alpha -tubulin (red, lower). (A) Increased expression of AFAP under hypoxia for 12 h were reduced after the treatment of ERK inhibitors. (B) Increased expression of alpha -tubulin under hypoxia for 12 h were reduced after the treatment of ERK inhibitors. Results are representative of three independent experiments, scale bar = 50 µM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31137604), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AFAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AFAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AFAP Protein (NBP1-90216PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AFAP Antibody - BSA Free

• actin filament associated protein 1
• AFAP
• AFAP1
• AFAP-110
• FLJ56849

Background

AFAP, or Actin filament-associated protein 1, contains a 81 kDa and a 90 kDa isoform, and is involved in the manipulation of actin filaments to form network or bundle structures and the regulation of cell-matrix linkage. Disease research is currently being conducted with AFAP and its relation to familial adenomatous polyposis, adenocarcinoma, breast cancer, prostate adenocarcinoma, prostatitis, polyposis, prostate cancer, and carcinoma. This protein interacts with PRKCB, PRKCD, PRKCG, ACTC1, and PRKCZ during the processes of signal transduction regulation and mechanical stimulus response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AFAP Antibody (NBP1-90216)(1)

Publication using NBP1-90216

• Morwitzer MJ, Tritsch SR, Cazares LH et al. Hypoxia-Induced Epithelial-To-Mesenchymal Transition Mediates Fibroblast Abnormalities via EKR Activation in Cutaneous Wound Healing Int J Mol Sci 2019-05-24 [PMID: 31137604] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: AFAP1
• Entrez:
  • 60312(Human)
• Uniprot:
  • Q8N556()