Advillin Antibody

Images

 
Western Blot: Advillin Antibody [NBP1-80007] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Advillin Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human AVIL (NP_006567). Peptide sequence: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AVIL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AVIL and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Advillin Antibody

  • ADVIL
  • advillin
  • DOC6
  • FLJ12386
  • MGC133244
  • p92DKFZp779O1812

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00064105-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
MAB1684
Species: Hu
Applications: WB
NB100-1985
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF2409
Species: Hu
Applications: Block, CyTOF-ready, Flow, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP1-89230
Species: Hu
Applications: IHC, IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
7954-GM/CF
Species: Hu
Applications: BA
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA

Publications for Advillin Antibody (NBP1-80007) (0)

There are no publications for Advillin Antibody (NBP1-80007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Advillin Antibody (NBP1-80007) (0)

There are no reviews for Advillin Antibody (NBP1-80007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Advillin Antibody (NBP1-80007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Advillin Products

Bioinformatics Tool for Advillin Antibody (NBP1-80007)

Discover related pathways, diseases and genes to Advillin Antibody (NBP1-80007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Advillin Antibody (NBP1-80007)

Discover more about diseases related to Advillin Antibody (NBP1-80007).
 

Pathways for Advillin Antibody (NBP1-80007)

View related products by pathway.

PTMs for Advillin Antibody (NBP1-80007)

Learn more about PTMs related to Advillin Antibody (NBP1-80007).
 

Research Areas for Advillin Antibody (NBP1-80007)

Find related products by research area.

Blogs on Advillin

There are no specific blogs for Advillin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Advillin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AVIL
Entrez
Uniprot