ADTB1 Antibody - Azide and BSA Free

Western Blot: ADTB1 Antibody [NBP2-92312] - Analysis of extracts of various cell lines, using ADTB1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5min.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADTB1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ADTB1 Antibody - Azide and BSA Free (NBP2-92312) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human AP1B1 (NP_001118.3). SDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ADTB1 Antibody - Azide and BSA Free

• Adapter-Related Protein Complex 1 Subunit Beta-1
• Adaptor Protein Complex AP-1 Subunit Beta-1
• Adaptor-Related Protein Complex 1, Beta 1 Subunit
• AP-1 Complex Subunit Beta-1
• AP105A
• AP1B1
• BAM22
• beta-1-adaptin
• beta1-adaptin
• Beta-Adaptin 1
• beta-prime-adaptin
• CLAPB2
• Clathrin Assembly Protein Complex 1 Beta Large Chain
• Golgi Adaptor HA1/AP1 Adaptin Beta Subunit
• Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit

Background

Membrane vesicle formation is a process required for the endocytosis and biosynthesis of various secreted and membrane bound proteins. Clathrin is a protein which assembles into a polyhedral network on the cell membrane as the membrane invaginates, forming a coated pit which is essential to endocytosis. Clathrin is composed of three polypeptides, a 180 kDa heavy chain and two 32-38 kDa light chains which combine to create a distinct three-legged triskelion. It is this morphology which allows Clathrin to form its unique polyhedral network.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: AP1B1