Adipolin/FAM132A Antibody


Immunocytochemistry/ Immunofluorescence: Adipolin/FAM132A Antibody [NBP1-90700] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adipolin/FAM132A Antibody [NBP1-90700] - Staining of human colon shows membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Adipolin/FAM132A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Adipolin/FAM132A Recombinant Protein Antigen (NBP1-90700PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Adipolin/FAM132A Antibody

  • Adipolin
  • Adipose-Derived Insulin-Sensitizing Factor
  • C1qDC2
  • C1qTNF12
  • CTRP12
  • FAM132A
  • family with sequence similarity 132, member A
  • protein FAM132A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Adipolin/FAM132A Antibody (NBP1-90700) (0)

There are no publications for Adipolin/FAM132A Antibody (NBP1-90700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adipolin/FAM132A Antibody (NBP1-90700) (0)

There are no reviews for Adipolin/FAM132A Antibody (NBP1-90700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Adipolin/FAM132A Antibody (NBP1-90700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Adipolin/FAM132A Products

Bioinformatics Tool for Adipolin/FAM132A Antibody (NBP1-90700)

Discover related pathways, diseases and genes to Adipolin/FAM132A Antibody (NBP1-90700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Adipolin/FAM132A

There are no specific blogs for Adipolin/FAM132A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Adipolin/FAM132A Antibody and receive a gift card or discount.


Gene Symbol FAM132A