ADI1 Antibody

Images

 
Western Blot: ADI1 Antibody [H00055256-B01P] - Analysis of ADI1 expression in transfected 293T cell line by ADI1 polyclonal antibody. Lane 1: MTCBP-1 transfected lysate(19.69 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADI1 Antibody Summary

Immunogen
ADI1 (NP_060739.1, 1 a.a. - 179 a.a.) full-length human protein. MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Specificity
ADI1 - acireductone dioxygenase 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ADI1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADI1 Antibody

  • 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  • Acireductone dioxygenase (Ni(2+)-requiring)
  • acireductone dioxygenase 1
  • APL1
  • ARDsubmergence induced protein 2
  • EC 1.13.11.53
  • FLJ10913
  • HMFT1638
  • membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1
  • Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
  • MTCBP1
  • MTCBP-1
  • Ni-ARD
  • SIPLMT1-MMP cytoplasmic tail-binding protein-1
  • Submergence-induced protein 2 homolog

Background

This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. A pseudogene that is located on chromosome 20 has been defined for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-428
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-87349
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1436
Species: Mu
Applications: WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-67415
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for ADI1 Antibody (H00055256-B01P) (0)

There are no publications for ADI1 Antibody (H00055256-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADI1 Antibody (H00055256-B01P) (0)

There are no reviews for ADI1 Antibody (H00055256-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADI1 Antibody (H00055256-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADI1 Products

Bioinformatics Tool for ADI1 Antibody (H00055256-B01P)

Discover related pathways, diseases and genes to ADI1 Antibody (H00055256-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADI1 Antibody (H00055256-B01P)

Discover more about diseases related to ADI1 Antibody (H00055256-B01P).
 

Pathways for ADI1 Antibody (H00055256-B01P)

View related products by pathway.

PTMs for ADI1 Antibody (H00055256-B01P)

Learn more about PTMs related to ADI1 Antibody (H00055256-B01P).

Blogs on ADI1

There are no specific blogs for ADI1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADI1
Entrez
Uniprot