ADAMTS9 Antibody


Immunohistochemistry-Paraffin: ADAMTS9 Antibody [NBP1-82915] - Staining of human small intestine shows strong cytoplasmic positivity in paneth cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ADAMTS9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGD
Specificity of human ADAMTS9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAMTS9 Recombinant Protein Antigen (NBP1-82915PEP)
Read Publication using NBP1-82915.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADAMTS9 Antibody

  • ADAM metallopeptidase with thrombospondin type 1 motif, 9
  • ADAMTS-9,9
  • FLJ42955


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for ADAMTS9 Antibody (NBP1-82915)(1)

Reviews for ADAMTS9 Antibody (NBP1-82915) (0)

There are no reviews for ADAMTS9 Antibody (NBP1-82915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAMTS9 Antibody (NBP1-82915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAMTS9 Products

Bioinformatics Tool for ADAMTS9 Antibody (NBP1-82915)

Discover related pathways, diseases and genes to ADAMTS9 Antibody (NBP1-82915). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS9 Antibody (NBP1-82915)

Discover more about diseases related to ADAMTS9 Antibody (NBP1-82915).

Pathways for ADAMTS9 Antibody (NBP1-82915)

View related products by pathway.

PTMs for ADAMTS9 Antibody (NBP1-82915)

Learn more about PTMs related to ADAMTS9 Antibody (NBP1-82915).

Blogs on ADAMTS9

There are no specific blogs for ADAMTS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAMTS9 Antibody and receive a gift card or discount.


Gene Symbol ADAMTS9