ADAMTS5 Recombinant Protein Antigen

Images

 
There are currently no images for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAMTS5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS5.

Source: E. coli

Amino Acid Sequence: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAMTS5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55653.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAMTS5 Recombinant Protein Antigen

  • A disintegrin and metalloproteinase with thrombospondin motifs 11
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2)
  • ADAM metallopeptidase with thrombospondin type 1 motif, 5
  • ADAM-TS 11
  • ADAM-TS 5
  • ADAMTS11
  • ADAMTS-11
  • ADAMTS5
  • ADAM-TS5
  • ADAMTS-5
  • ADMP2
  • ADMP-2
  • ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5
  • Aggrecanase 2
  • aggrecanase-2
  • disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.14
  • EC 3.4.24.82

Background

ADAMTS5, also known as aggrecanase-2, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan. The protein contains a signal sequence, a prodomain with both a potential cysteine switch and a furin cleavage site, a metalloproteinase domain with a conserved zinc-binding motif and a 'met turn,' a disintegrin-like domain, and a spacer region between a thrombospondin type 1 motif and thrombospondin submotif. At least four transcript variants have been reported. ADAMTS5 has been implicated in inflammatory joint diseases. ADAMTS5 expression has been documented in a range of normal human tissues. ESTs have been isolated from human tissue libraries, including normal breast, embryo and heart and cancerous placenta and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY4307-05
Species: Hu
Applications: ELISA
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF5465
Species: Hu
Applications: IP, WB
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DM1300
Species: Hu
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
973-TM
Species: Hu
Applications: InhibAct
DTM100
Species: Hu
Applications: ELISA
201-LB
Species: Hu
Applications: BA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
M6000B
Species: Mu
Applications: ELISA
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-55653PEP
Species: Hu
Applications: AC

Publications for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP) (0)

There are no publications for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP) (0)

There are no reviews for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS5 Products

Research Areas for ADAMTS5 Recombinant Protein Antigen (NBP2-55653PEP)

Find related products by research area.

Blogs on ADAMTS5

There are no specific blogs for ADAMTS5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAMTS5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS5