ADAM29 Antibody (3A6) - Azide and BSA Free

Sandwich ELISA: ADAM29 Antibody (3A6) [H00011086-M09] - Detection limit for recombinant GST tagged ADAM29 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 3A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADAM29 Antibody (3A6) - Azide and BSA Free Summary

• Immunogen: ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
• Specificity: Reacts with ADAM metallopeptidase domain 29.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADAM29
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADAM29 Antibody (3A6) - Azide and BSA Free

• ADAM 29
• ADAM metallopeptidase domain 29
• Cancer/testis antigen 73
• CT73a disintegrin and metalloproteinase domain 29
• disintegrin and metalloproteinase domain-containing protein 29
• EC 3.4.24
• EC 3.4.24.58
• svph1

Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAM29 Antibody (H00011086-M09)(3)

Publications using H00011086-M09

• Junyan Z, Mirzo K, Keith J et al. Germ cell-specific proteins AKAP4 and ASPX facilitate identification of rare spermatozoa in non-obstructive azoospermia. Mol Cell Proteomics. 2023-04-21 [PMID: 37087050]
• Schiza C, Korbakis D, Jarvi K et al. Identification of TEX101-associated Proteins Through Proteomic Measurement of Human Spermatozoa Homozygous for the Missense Variant rs35033974 Molecular & Cellular Proteomics 2019-02-01 [PMID: 30429210]
• Zhao M, Jia W, Jiang WG et al. ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro. Anticancer Res 2016-03-01 [PMID: 26977022]

Bioinformatics

• Gene Symbol: ADAM29
• Entrez:
  • 11086(Human)
• Uniprot:
  • NP_055084(Human)