ADAM29 Antibody - BSA Free

Western Blot: ADAM29 Antibody [NBP2-83927] - WB Suggested Anti-Adam29 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Thymus

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAM29 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of ADAM29. Peptide sequence: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM29
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAM29 Antibody - BSA Free

• ADAM 29
• ADAM metallopeptidase domain 29
• Cancer/testis antigen 73
• CT73a disintegrin and metalloproteinase domain 29
• disintegrin and metalloproteinase domain-containing protein 29
• EC 3.4.24
• EC 3.4.24.58
• svph1

Background

ADAM29, or Disintegrin and metalloproteinase domain-containing protein29, contains an alpha 93 kDa isoform, a beta 87 kDa isoform, and a gamma 90 kDa isoform, and is involved in the processes of fertilization and spermatogenesis. Current research is being conducted on the protein's relation to a variety of cancers, including chronic lymphocytic leukemia, lymphocytic leukemia, and melanoma. ADAM29 has been linked to the processes of proteolysis and spermatogenesis, in which it interacts with ABI2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM29