ADAM29 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ADAM29 Antibody - BSA Free (NBP2-83927) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of ADAM29. Peptide sequence: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADAM29 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ADAM29 Antibody - BSA Free
Background
ADAM29, or Disintegrin and metalloproteinase domain-containing protein29, contains an alpha 93 kDa isoform, a beta 87 kDa isoform, and a gamma 90 kDa isoform, and is involved in the processes of fertilization and spermatogenesis. Current research is being conducted on the protein's relation to a variety of cancers, including chronic lymphocytic leukemia, lymphocytic leukemia, and melanoma. ADAM29 has been linked to the processes of proteolysis and spermatogenesis, in which it interacts with ABI2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IP (-), WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Publications for ADAM29 Antibody (NBP2-83927) (0)
There are no publications for ADAM29 Antibody (NBP2-83927).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM29 Antibody (NBP2-83927) (0)
There are no reviews for ADAM29 Antibody (NBP2-83927).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADAM29 Antibody (NBP2-83927) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADAM29 Products
Blogs on ADAM29