ADAM2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining in human testis and liver tissues using anti-ADAM2 antibody. Corresponding ADAM2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAM2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLNQWICIDGVCMSGDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ADAM2 Protein (NBP1-85415PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADAM2 Antibody - BSA Free

• ADAM metallopeptidase domain 2
• ADAM2
• Cancer/testis antigen 15
• CRYN2
• CT15
• CT15ADAM 2
• disintegrin and metalloproteinase domain-containing protein 2
• EC 3.4.24
• Fertilin beta
• Fertilin subunit beta
• FTNBCRYN1
• PH30
• PH-30
• PH-30b
• PH30-beta
• PH30PH30-beta

Background

ADAM2, or Disintegrin and metalloproteinase domain-containing protein 2, contains a 82 kDa and a 80 kDa isoform, and is involved in the adhesion of the sperm-egg membrane during fertilization. Current research is being conducted to determine the relationship between ADAM2 and a variety of disorders and diseases, including infertility, epidiymitis, Alzheimer's disease, and reflex sympathetic dystrophy. ADAM2 has been linked to the integrin-mediated signaling pathway and processes involving cellular adhesion, through which it interacts with CD9, CLGN, CRYAB, DNM1, and ITGA9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM2
• Entrez:
  • 2515(Human)
• Uniprot:
  • Q99965(Human)