ADAM2 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining in human testis and liver tissues using anti-ADAM2 antibody. Corresponding ADAM2 RNA-seq data are presented for the more
Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85415] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ADAM2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLNQWICIDGVCMSGDK
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAM2 Protein (NBP1-85415PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADAM2 Antibody

  • ADAM metallopeptidase domain 2
  • ADAM2
  • Cancer/testis antigen 15
  • CRYN2
  • CT15
  • CT15ADAM 2
  • disintegrin and metalloproteinase domain-containing protein 2
  • EC 3.4.24
  • Fertilin beta
  • Fertilin subunit beta
  • PH30
  • PH-30
  • PH-30b
  • PH30-beta
  • PH30PH30-beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for ADAM2 Antibody (NBP1-85415) (0)

There are no publications for ADAM2 Antibody (NBP1-85415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM2 Antibody (NBP1-85415) (0)

There are no reviews for ADAM2 Antibody (NBP1-85415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAM2 Antibody (NBP1-85415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAM2 Products

Bioinformatics Tool for ADAM2 Antibody (NBP1-85415)

Discover related pathways, diseases and genes to ADAM2 Antibody (NBP1-85415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM2 Antibody (NBP1-85415)

Discover more about diseases related to ADAM2 Antibody (NBP1-85415).

Pathways for ADAM2 Antibody (NBP1-85415)

View related products by pathway.

PTMs for ADAM2 Antibody (NBP1-85415)

Learn more about PTMs related to ADAM2 Antibody (NBP1-85415).

Blogs on ADAM2

There are no specific blogs for ADAM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAM2 Antibody and receive a gift card or discount.


Gene Symbol ADAM2