ADAM15 Recombinant Protein Antigen

Images

 
There are currently no images for ADAM15 Protein (NBP1-82788PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADAM15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM15.

Source: E. coli

Amino Acid Sequence: CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAM15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82788.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAM15 Recombinant Protein Antigen

  • ADAM 15
  • ADAM metallopeptidase domain 15
  • ADAM15
  • disintegrin-like, and cysteine-rich protein 15
  • EC 3.4.24
  • MDC15
  • MDC-15
  • Metargidin

Background

ADAM15 is encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF949
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
936-AD
Species: Hu
Applications: EnzAct
930-ADB
Species: Hu
Applications: EnzAct
NB300-889
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1031
Species: Hu
Applications: ICC, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-85416
Species: Hu
Applications: IHC,  IHC-P
NBP2-92621
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
236-EG
Species: Hu
Applications: BA
DMD00
Species: Hu
Applications: ELISA
973-TM
Species: Hu
Applications: InhibAct
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82788PEP
Species: Hu
Applications: AC

Publications for ADAM15 Protein (NBP1-82788PEP) (0)

There are no publications for ADAM15 Protein (NBP1-82788PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM15 Protein (NBP1-82788PEP) (0)

There are no reviews for ADAM15 Protein (NBP1-82788PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAM15 Protein (NBP1-82788PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM15 Products

Research Areas for ADAM15 Protein (NBP1-82788PEP)

Find related products by research area.

Blogs on ADAM15

There are no specific blogs for ADAM15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAM15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM15