ACTRT1 Antibody

Images

 
Immunohistochemistry-Paraffin: ACTRT1 Antibody [NBP1-89184] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTRT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFYLSNHAVAALYASACVTGLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACTRT1 Protein (NBP1-89184PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTRT1 Antibody

  • actin-related protein T1
  • AIP1
  • ARIP1
  • Arp-T1
  • ARPT1HSD27
  • KIAA0705
  • MGC26590

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ACTRT1 Antibody (NBP1-89184) (0)

There are no publications for ACTRT1 Antibody (NBP1-89184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTRT1 Antibody (NBP1-89184) (0)

There are no reviews for ACTRT1 Antibody (NBP1-89184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACTRT1 Antibody (NBP1-89184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTRT1 Products

Bioinformatics Tool for ACTRT1 Antibody (NBP1-89184)

Discover related pathways, diseases and genes to ACTRT1 Antibody (NBP1-89184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ACTRT1 Antibody (NBP1-89184)

View related products by pathway.

Blogs on ACTRT1

There are no specific blogs for ACTRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT1
Entrez
Uniprot