actin-related protein 2/3 complex subunit 1B Recombinant Protein Antigen

Images

 
There are currently no images for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

actin-related protein 2/3 complex subunit 1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARPC1B.

Source: E. coli

Amino Acid Sequence: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARPC1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90114.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for actin-related protein 2/3 complex subunit 1B Recombinant Protein Antigen

  • actin related protein 2/3 complex, subunit 1B (41 kD)
  • actin related protein 2/3 complex, subunit 1B, 41kDa
  • actin-related protein 2/3 complex subunit 1B
  • ARC41p41-ARCp40-ARC
  • Arp2/3 complex 41 kDa subunit
  • ARP2/3 protein complex subunit p41

Background

actin-related protein 2/3 complex subunit 1B encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89016
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1037
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-69003
Species: Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB110-55244
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45504
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-47477
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
NBP1-76836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-92846
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-90114PEP
Species: Hu
Applications: AC

Publications for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP) (0)

There are no publications for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP) (0)

There are no reviews for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for actin-related protein 2/3 complex subunit 1B Protein (NBP1-90114PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional actin-related protein 2/3 complex subunit 1B Products

Blogs on actin-related protein 2/3 complex subunit 1B

There are no specific blogs for actin-related protein 2/3 complex subunit 1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our actin-related protein 2/3 complex subunit 1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPC1B