ACF1 Antibody - BSA Free

Western Blot: ACF1 Antibody [NBP3-10958] - Western blot analysis using NBP3-10958 on Human Stomach as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ACF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACF1 Antibody - BSA Free (NBP3-10958) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACF1 (NP_038476). Peptide sequence SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAZ1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 179 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACF1 Antibody - BSA Free

• ACF1hWALp1
• ATP-dependent chromatin remodeling protein
• ATP-dependent chromatin-remodeling protein
• ATP-utilizing chromatin assembly and remodeling factor 1
• bromodomain adjacent to zinc finger domain protein 1A
• bromodomain adjacent to zinc finger domain, 1A
• CHRAC subunit ACF1
• hACF1FLJ14383
• WALp1
• WCRF180DKFZp586E0518
• Williams syndrome transcription factor-related chromatin-remodeling factor 180

Background

ACF1/BAZ1A is a subunit of the ACF chromatin-remodeling complex and the ISWI CHRAC remodeling complex. In the ACF complex, ACF1/BAZ1A functions to influence the nucleosome remodeling activity of the SNF2h ATPase. As part of the CHRAC complex, ACF1/BAZ1A may function to target CHRAC to heterochromatin. ACF1 has also been shown to interact with the nuclear receptor corepressor protein (N-CoR) to facilitate the repression of transcription by unliganded nuclear receptors. Alternate names for ACF1/BAZ1A include ATP-utilizing chromatin assembly and remodeling factor1, hACF1, bromodomain adjacent to zinc finger domain protein 1A, Williams syndrome transcription factor-related chromatin-remodeling factor 180, WCRF180, hWALp1, and CHRAC subunit ACF1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAZ1A