Acetyl-coenzyme A transporter 1 Antibody

Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-90811] - Analysis in control (vector only transfected HEK293T lysate) and SLC33A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Acetyl-coenzyme A transporter 1 Antibody [NBP1-90811] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Discontinued

Acetyl-coenzyme A transporter 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTPDAVELCKKLGGSCVT
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC33A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Acetyl-coenzyme A transporter 1 Antibody

• ACATNAcetyl-CoA transporter 1
• acetyl-Coenzyme A transporter
• AT-1acetyl-coenzyme A transporter 1
• AT1SPG42
• solute carrier family 33 (acetyl-CoA transporter), member 1
• Solute carrier family 33 member 1
• spastic paraplegia 42 (autosomal dominant)

Background

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC33A1
• Entrez:
  • 9197(Human)
• Uniprot:
  • O00400(Human)