ACADVL Antibody (1E7)

Product Discontinued

ACADVL Antibody (1E7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ACADVL
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACADVL Antibody (1E7)

• ACAD6
• acyl-CoA dehydrogenase, very long chain
• acyl-Coenzyme A dehydrogenase, very long chain
• EC 1.3.99
• EC 1.3.99.-
• LCACD
• very long-chain specific acyl-CoA dehydrogenase, mitochondrial
• VLCAD

Background

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACADVL
• Uniprot:
  • NP_000009(Human)