Recombinant Human ABI1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABI1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 185-238 of Human ABI1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABI1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABI1 Protein

  • Abelson interactor 1
  • ABI-1
  • abl interactor 1
  • Abl-binding protein 4
  • ablBP4
  • abl-interactor 1
  • Abl-interactor protein 1 long
  • E3B1
  • eps8 binding protein
  • Eps8 SH3 domain-binding protein
  • Eps8-binding protein
  • interactor protein AblBP4
  • nap1 binding protein
  • Nap1-binding protein
  • Nap1BP
  • spectrin SH3 domain binding protein 1
  • Spectrin SH3 domain-binding protein 1
  • SSH3BP
  • SSH3BP1

Background

ABI1 - abl-interactor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49637
Species: Hu
Applications: WB, IHC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP2-27300
Species: Hu
Applications: WB, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no publications for ABI1 Partial Recombinant Protein (H00010006-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no reviews for ABI1 Partial Recombinant Protein (H00010006-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABI1 Products

Bioinformatics Tool for ABI1 Partial Recombinant Protein (H00010006-Q01)

Discover related pathways, diseases and genes to ABI1 Partial Recombinant Protein (H00010006-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABI1 Partial Recombinant Protein (H00010006-Q01)

Discover more about diseases related to ABI1 Partial Recombinant Protein (H00010006-Q01).
 

Pathways for ABI1 Partial Recombinant Protein (H00010006-Q01)

View related products by pathway.

PTMs for ABI1 Partial Recombinant Protein (H00010006-Q01)

Learn more about PTMs related to ABI1 Partial Recombinant Protein (H00010006-Q01).

Blogs on ABI1

There are no specific blogs for ABI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABI1 Antibody
NB100-59845

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABI1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABI1