Home » ABI1 » ABI1 Proteins » Recombinant Human ABI1 Protein

Recombinant Human ABI1 Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human ABI1 Protein [H00010006-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human ABI1 Protein [H00010006-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human ABI1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 185-238 of Human ABI1

Source: Wheat Germ

Amino Acid Sequence: GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
31.68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABI1 Protein

  • Abelson interactor 1
  • ABI1
  • ABI-1
  • abl interactor 1
  • Abl-binding protein 4
  • ABLBP4
  • abl-interactor 1
  • Abl-interactor protein 1 long
  • E3B1
  • eps8 binding protein
  • Eps8 SH3 domain-binding protein
  • Eps8-binding protein
  • interactor protein AblBP4
  • nap1 binding protein
  • Nap1-binding protein
  • NAP1BP
  • spectrin SH3 domain binding protein 1
  • Spectrin SH3 domain-binding protein 1
  • SSH3BP
  • SSH3BP1

Background

ABI1 - abl-interactor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABI2 Antibody
H00010152-D01P
Western Blot: ABI2 Antibody [H00010152-D01P] - Analysis of ABI2 expression in human kidney.
Immunocytochemistry/Immunofluorescence: ABI2 Antibody [H00010152-D01P] - Analysis of antibody to ABI2 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: ABI2 Antibody [H00010152-D01P] - Analysis of ABI2 expression in transfected 293T cell line by ABI2 polyclonal antibody.Lane 1: ABI2 transfected lysate(52.40 KDa).Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA, ICC/IF
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, Simple Western
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
AKT1 [p Ser473]
Antibody (104A282)
NB100-56749
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - Total protein from mouse 3T3 cells treated with and without PDGF (50 ng/mL) for the indicated times was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-AKT1 (NBP2-01725) and 2 ug/mL pS473 AKT1 in 1% BSA in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the detection of phosphorylated AKT1 in response to PDGF treatment compared to total AKT1 protein.
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - WB of phospho AKT using phospho AKT antibody at 2 ug/mL against untreated (lane 1) and PDGF treated (lane 2) NIH-3T3 lysate. HRP conjugated secondary antibody and ECL substrate solution were used for this test. Image using the Azide and BSA Free form of this antibody.
Immunohistochemistry-Paraffin: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - IHC analysis of an FFPE human breast carcinoma tissue section using 1:250 dilution of phospho Ser473 AKT1 antibody (clone 104A282) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of phosphor-AKT (Ser-473) in the cancer cells as well as the stromal cells. Staining was performed by Histowiz.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
WASF1/WAVE1
Antibody
AF5514
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, A172 human glioblastoma cell line, and 293T human embryonic kidney cell line, and mouse brain tissue. PVDF membrane was probed with 1 µg/mL of Human/Mouse WASF1/WAVE1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5514) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WASF1/WAVE1 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu
Applications: WB
WASF2 Antibody
NBP2-37912
Immunocytochemistry/Immunofluorescence: WASF2 Antibody [NBP2-37912] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antiibody staining is shown in green.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: WASF2 Antibody [NBP2-37912] - Analysis in human esophagus and skeletal muscle tissues. Corresponding WASF2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MTTP Antibody
NBP1-62489
Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
Eps8 Antibody
(18F1F2)
NBP2-27300
Western Blot: EPS8 Antibody (18F1F2) [NBP2-27300] - analysis of EPS8 partial recombinant protein using EPS8 antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: EPS8 Antibody (18F1F2) [NBP2-27300] - Formalin-fixed, paraffin-embedded human colon cancer stained with EPS8 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen.
Species: Hu
Applications: WB, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
ABI3 Antibody
NBP2-30583
Western Blot: ABI3 Antibody [NBP2-30583] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: ABI3 Antibody [NBP2-30583] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: ABI3 Antibody [NBP2-30583] - Analysis in human tonsil and pancreas tissues. Corresponding ABI3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - ACTR2 monoclonal antibody (M01), clone 1B10-C4 Analysis of ACTR2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Mena Antibody
NBP1-87914
Western Blot: Mena Antibody [NBP1-87914] - Analysis using Anti-ENAH antibody NBP1-87914 (A) shows similar pattern to independent antibody NBP1-87915 (B).
Immunocytochemistry/Immunofluorescence: Mena Antibody [NBP1-87914] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Mena Antibody [NBP1-87914] - Staining of human fallopian tube, liver, prostate and testis using Anti-ENAH antibody (A) NBP1-87914 shows similar protein distribution across tissues to independent antibody NBP1-87915 (B).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(15 Reviews)
(439 Publications)
Species: Hu
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western blot shows lysates of mouse uterus tissue and MEF mouse embryonic feeder cells. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 2/ANGPTL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1444) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Angiopoietin‑like Protein 2/ANGPTL2 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: WB, IHC
AICDA Antibody
NBP1-30955
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded mouse lymph node. AICDA antibody [N1N2], N-term dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NCKAP1 Antibody
NBP1-83269
Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC

Publications for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no publications for ABI1 Partial Recombinant Protein (H00010006-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no reviews for ABI1 Partial Recombinant Protein (H00010006-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABI1 Partial Recombinant Protein (H00010006-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional ABI1 Products

Bioinformatics Tool for ABI1 Partial Recombinant Protein (H00010006-Q01)

Discover related pathways, diseases and genes to ABI1 Partial Recombinant Protein (H00010006-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABI1 Partial Recombinant Protein (H00010006-Q01)

Discover more about diseases related to ABI1 Partial Recombinant Protein (H00010006-Q01).
 

Pathways for ABI1 Partial Recombinant Protein (H00010006-Q01)

View related products by pathway.

PTMs for ABI1 Partial Recombinant Protein (H00010006-Q01)

Learn more about PTMs related to ABI1 Partial Recombinant Protein (H00010006-Q01).

Blogs on ABI1

There are no specific blogs for ABI1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
EGF [Unconjugated]
236-EG-200
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - Total protein from mouse 3T3 cells treated with and without PDGF (50 ng/mL) for the indicated times was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-AKT1 (NBP2-01725) and 2 ug/mL pS473 AKT1 in 1% BSA in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the detection of phosphorylated AKT1 in response to PDGF treatment compared to total AKT1 protein.
AKT1 [p Ser473] Antibody (104A282)
NB100-56749

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABI1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ABI1
COVID-19 update