ABCB7 Antibody

Images

 
Western Blot: ABCB7 Antibody [NBP2-84372] - Host: Rabbit. Target Name: ABCB7. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/mlABCB7 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABCB7. Peptide sequence: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCB7 Antibody

  • ABC transporter 7 protein
  • ABC7ATP-binding cassette sub-family B member 7, mitochondrial
  • ASATATP-binding cassette 7
  • Atm1p
  • ATP-binding cassette transporter 7
  • ATP-binding cassette, sub-family B (MDR/TAP), member 7
  • EC 3.6.3
  • EC 3.6.3.42
  • EST140535

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-54724
Species: Hu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-35006
Species: Hu
Applications: Func, PAGE
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-84372
Species: Hu
Applications: WB

Publications for ABCB7 Antibody (NBP2-84372) (0)

There are no publications for ABCB7 Antibody (NBP2-84372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB7 Antibody (NBP2-84372) (0)

There are no reviews for ABCB7 Antibody (NBP2-84372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCB7 Antibody (NBP2-84372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCB7 Products

Bioinformatics Tool for ABCB7 Antibody (NBP2-84372)

Discover related pathways, diseases and genes to ABCB7 Antibody (NBP2-84372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB7 Antibody (NBP2-84372)

Discover more about diseases related to ABCB7 Antibody (NBP2-84372).
 

Pathways for ABCB7 Antibody (NBP2-84372)

View related products by pathway.

PTMs for ABCB7 Antibody (NBP2-84372)

Learn more about PTMs related to ABCB7 Antibody (NBP2-84372).
 

Research Areas for ABCB7 Antibody (NBP2-84372)

Find related products by research area.

Blogs on ABCB7

There are no specific blogs for ABCB7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB7