ABCB10 Antibody

Images

 
Western Blot: ABCB10 Antibody [NBP1-69065] - Rat Muscle, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB10 Antibody Summary

Immunogen
The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Abcb10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Abcb10 and was validated on Western blot.
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCB10 Antibody

  • ABC transporter 10 protein
  • ATP-binding cassette, sub-family B (MDR/TAP), member 10
  • EC 3.6.3
  • EC 3.6.3.44
  • EST20237
  • M-ABC2ATP-binding cassette transporter 10
  • Mitochondrial ATP-binding cassette 2
  • MTABC2ATP-binding cassette sub-family B member 10, mitochondrial

Background

Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91643
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48743
Species: Hu
Applications: IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ABCB10 Antibody (NBP1-69065) (0)

There are no publications for ABCB10 Antibody (NBP1-69065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB10 Antibody (NBP1-69065) (0)

There are no reviews for ABCB10 Antibody (NBP1-69065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCB10 Antibody (NBP1-69065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCB10 Products

Bioinformatics Tool for ABCB10 Antibody (NBP1-69065)

Discover related pathways, diseases and genes to ABCB10 Antibody (NBP1-69065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB10 Antibody (NBP1-69065)

Discover more about diseases related to ABCB10 Antibody (NBP1-69065).
 

Pathways for ABCB10 Antibody (NBP1-69065)

View related products by pathway.

Blogs on ABCB10

There are no specific blogs for ABCB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Abcb10
Entrez
Uniprot