Recombinant Human A33/GPA33 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human A33/GPA33 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-125 of Human A33/GPA33

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPA33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human A33/GPA33 GST (N-Term) Protein

  • A33
  • cell surface A33 antigen
  • glycoprotein A33 (transmembrane)
  • Glycoprotein A33
  • GPA33
  • MGC129986
  • MGC129987
  • transmembrane glycoprotein A33

Background

The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83552
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
314-BP/CF
Species: Hu
Applications: BA, BA
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB600-1182
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB4818
Species: Hu
Applications: IHC, Simple Western, WB
210-TA
Species: Hu
Applications: BA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB4734
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-76526
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3027
Species: Mu
Applications: WB

Publications for A33/GPA33 Partial Recombinant Protein (H00010223-Q01) (0)

There are no publications for A33/GPA33 Partial Recombinant Protein (H00010223-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A33/GPA33 Partial Recombinant Protein (H00010223-Q01) (0)

There are no reviews for A33/GPA33 Partial Recombinant Protein (H00010223-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for A33/GPA33 Partial Recombinant Protein (H00010223-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional A33/GPA33 Products

Bioinformatics Tool for A33/GPA33 Partial Recombinant Protein (H00010223-Q01)

Discover related pathways, diseases and genes to A33/GPA33 Partial Recombinant Protein (H00010223-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A33/GPA33 Partial Recombinant Protein (H00010223-Q01)

Discover more about diseases related to A33/GPA33 Partial Recombinant Protein (H00010223-Q01).
 

Pathways for A33/GPA33 Partial Recombinant Protein (H00010223-Q01)

View related products by pathway.

PTMs for A33/GPA33 Partial Recombinant Protein (H00010223-Q01)

Learn more about PTMs related to A33/GPA33 Partial Recombinant Protein (H00010223-Q01).
 

Research Areas for A33/GPA33 Partial Recombinant Protein (H00010223-Q01)

Find related products by research area.

Blogs on A33/GPA33

There are no specific blogs for A33/GPA33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human A33/GPA33 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPA33