A-RAF Recombinant Protein Antigen

Images

 
There are currently no images for A-RAF Recombinant Protein Antigen (NBP2-55054PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

A-RAF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human A-RAF.

Source: E. coli

Amino Acid Sequence: DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55054.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for A-RAF Recombinant Protein Antigen

  • ARaf
  • A-Raf
  • ARAF1A-RAF
  • EC 2.7.11
  • EC 2.7.11.1
  • Oncogene ARAF1
  • PKS
  • PKS2
  • PKS2A-Raf proto-oncogene serine/threonine-protein kinase
  • Proto-oncogene A-Raf
  • Proto-oncogene A-Raf-1
  • Proto-oncogene Pks
  • RAFA1
  • Ras-binding protein DA-Raf
  • serine/threonine-protein kinase A-Raf
  • v-raf murine sarcoma 3611 viral oncogene homolog 1
  • v-raf murine sarcoma 3611 viral oncogene homolog

Background

Several serine/threonine protein kinases have been implicated as intermediates in signal transduction pathways. These include ERK/MAP kinases, ribosomal S6 kinase (Rsk) and Raf-1. Raf-1 is a cytoplasmic protein with intrinsic serine/threonine activity. It is broadly expressed in nearly all cell lines tested to date and is the cellular homolog of v-Raf, the product of the transforming gene of the 3611 strain of murine sarcoma virus. The unregulated kinase activity of the v-Raf protein has been associated with transformation and mitogenesis while the activity of Raf-1 is normally suppressed by a regulatory N-terminal domain. A-Raf, a second member of the Raf gene family of serine/ threonine protein kinases, exhibits substantial homology to Raf-1 within the kinase domain of the two molecules, but less homology elsewhere. Expression of A-Raf is found at highest levels in urogenital tissues and kidney and at lowest level in brain tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33710
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-43792
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-84730
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DNST0
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, KO, PEP-ELISA, WB
NBP1-42342
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
DTM100
Species: Hu
Applications: ELISA
NBP2-55054PEP
Species: Hu
Applications: AC

Publications for A-RAF Recombinant Protein Antigen (NBP2-55054PEP) (0)

There are no publications for A-RAF Recombinant Protein Antigen (NBP2-55054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A-RAF Recombinant Protein Antigen (NBP2-55054PEP) (0)

There are no reviews for A-RAF Recombinant Protein Antigen (NBP2-55054PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for A-RAF Recombinant Protein Antigen (NBP2-55054PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional A-RAF Products

Research Areas for A-RAF Recombinant Protein Antigen (NBP2-55054PEP)

Find related products by research area.

Blogs on A-RAF

There are no specific blogs for A-RAF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our A-RAF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARAF