5-Lipoxygenase Recombinant Protein Antigen

Images

 
There are currently no images for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

5-Lipoxygenase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 5-Lipoxygenase.

Source: E. coli

Amino Acid Sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALOX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56011.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-Lipoxygenase Recombinant Protein Antigen

  • 5Lipoxygenase
  • 5-Lipoxygenase
  • 5-LO
  • 5-LOX
  • 5LPG
  • ALOX5
  • arachidonate 5-lipoxygenase
  • arachidonic 5-lipoxygenase alpha-10 isoform
  • arachidonic 5-lipoxygenase delta-10-13 isoform
  • arachidonic 5-lipoxygenase delta-13 isoform
  • arachidonic 5-lipoxygenase delta-p10 isoform
  • arachidonic acid 5-lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.34
  • leukotriene A4 synthase
  • LOG5
  • LOX5A
  • MGC163204

Background

5 Lipoxygenase encodes a protein which, with Arachidonate 5-lipoxygenase-activating protein, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-891
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
211-TBB/CF
Species: Hu
Applications: BA
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1684
Species: Hu
Applications: WB
NBP3-35458
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC,  IHC-P, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-01740
Species: Ca, Hu, Pm, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-47829
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP2-56011PEP
Species: Hu
Applications: AC

Publications for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP) (0)

There are no publications for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP) (0)

There are no reviews for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-Lipoxygenase Products

Research Areas for 5-Lipoxygenase Recombinant Protein Antigen (NBP2-56011PEP)

Find related products by research area.

Blogs on 5-Lipoxygenase

There are no specific blogs for 5-Lipoxygenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5-Lipoxygenase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX5