5-HT2B Antibody (4F3)

Images

 
There are currently no images for 5-HT2B Antibody (H00003357-M09).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

5-HT2B Antibody (4F3) Summary

Immunogen
HTR2B (AAH63123.1 199 a.a. - 359 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ
Specificity
HTR2B - 5-hydroxytryptamine (serotonin) receptor 2B (4F3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HTR2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5-HT2B Antibody (4F3)

  • 5-HT(2B)
  • 5HT2B
  • 5-HT2B
  • 5-HT-2B
  • 5-HT2B5-HT 2B receptor
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • 5-hydroxytryptamine 2B receptor
  • 5-hydroxytryptamine receptor 2B
  • HTR2B
  • Serotonin receptor 2B

Background

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for 5-HT2B Antibody (H00003357-M09) (0)

There are no publications for 5-HT2B Antibody (H00003357-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2B Antibody (H00003357-M09) (0)

There are no reviews for 5-HT2B Antibody (H00003357-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT2B Antibody (H00003357-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT2B Products

Bioinformatics Tool for 5-HT2B Antibody (H00003357-M09)

Discover related pathways, diseases and genes to 5-HT2B Antibody (H00003357-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2B Antibody (H00003357-M09)

Discover more about diseases related to 5-HT2B Antibody (H00003357-M09).
 

Pathways for 5-HT2B Antibody (H00003357-M09)

View related products by pathway.

PTMs for 5-HT2B Antibody (H00003357-M09)

Learn more about PTMs related to 5-HT2B Antibody (H00003357-M09).
 

Research Areas for 5-HT2B Antibody (H00003357-M09)

Find related products by research area.

Blogs on 5-HT2B

There are no specific blogs for 5-HT2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT2B Antibody (4F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2B
Entrez
Uniprot