15-Lipoxygenase 2 Antibody (4A7)

Images

 
Immunocytochemistry/ Immunofluorescence: 15-Lipoxygenase 2 Antibody (4A7) [H00000247-M05] - Analysis of monoclonal antibody to ALOX15B on HeLa cell. Antibody concentration 10 ug/ml
ELISA: 15-Lipoxygenase 2 Antibody (4A7) [H00000247-M05] - Detection limit for recombinant GST tagged ALOX15B is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

15-Lipoxygenase 2 Antibody (4A7) Summary

Immunogen
ALOX15B (AAH35217.1, 181 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
Specificity
ALOX15B - arachidonate 15-lipoxygenase, type B (4A7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALOX15B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 15-Lipoxygenase 2 Antibody (4A7)

  • 15-lipoxygenase 2
  • 15-LOX-B
  • arachidonate 15-lipoxygenase 2
  • arachidonate 15-lipoxygenase B
  • Arachidonate 15-lipoxygenase type II
  • arachidonate 15-lipoxygenase, second type
  • arachidonate 15-lipoxygenase, type B
  • arachidonate omega(6) lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.33,15-LOX-215S-lipoxygenase

Background

This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for 15-Lipoxygenase 2 Antibody (H00000247-M05) (0)

There are no publications for 15-Lipoxygenase 2 Antibody (H00000247-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 15-Lipoxygenase 2 Antibody (H00000247-M05) (0)

There are no reviews for 15-Lipoxygenase 2 Antibody (H00000247-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 15-Lipoxygenase 2 Antibody (H00000247-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 15-Lipoxygenase 2 Products

Bioinformatics Tool for 15-Lipoxygenase 2 Antibody (H00000247-M05)

Discover related pathways, diseases and genes to 15-Lipoxygenase 2 Antibody (H00000247-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-Lipoxygenase 2 Antibody (H00000247-M05)

Discover more about diseases related to 15-Lipoxygenase 2 Antibody (H00000247-M05).
 

Pathways for 15-Lipoxygenase 2 Antibody (H00000247-M05)

View related products by pathway.

PTMs for 15-Lipoxygenase 2 Antibody (H00000247-M05)

Learn more about PTMs related to 15-Lipoxygenase 2 Antibody (H00000247-M05).
 

Research Areas for 15-Lipoxygenase 2 Antibody (H00000247-M05)

Find related products by research area.

Blogs on 15-Lipoxygenase 2

There are no specific blogs for 15-Lipoxygenase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 15-Lipoxygenase 2 Antibody (4A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX15B
Entrez
Uniprot