14-3-3 zeta/delta Antibody - BSA Free

Western Blot: 14-3-3 zeta/delta Antibody [NBP2-92813] - Analysis of extracts of various cell lines, using 14-3-3 zeta/delta at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

Immunohistochemistry-Paraffin: 14-3-3 zeta/delta Antibody [NBP2-92813] - Rat kidney using YWHAZ Rabbit pAb at dilution of 1:100 (40x lens).

Immunocytochemistry/ Immunofluorescence: 14-3-3 zeta/delta Antibody - Azide and BSA Free [NBP2-92813] - Immunofluorescence analysis of paraffin-embedded Rat brain using 14-3-3 zeta/delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

14-3-3 zeta/delta Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta/delta (NP_003397.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YWHAZ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for 14-3-3 zeta/delta Antibody - BSA Free

• KCIP-1MGC126532,14-3-3-zeta
• MGC111427
• MGC138156
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide
• zeta polypeptide

Background

14-3-3 proteins are highly conserved proteins which play a role in both signal transduction and progression through the cell cycle by binding to and regulating several different proteins. 14-3-3 proteins activate tyrosine and tryptophan hydroxylases and protein kinase C. They mediate signal transduction by binding to phosphoserine-containing proteins. There are at least 7 mammalian isoforms: alpha, beta, gamma, delta, epsilon, zeta, and eta. An eighth subtype, termed theta has been found in rat brain. The 14-3-3 proteins exist in vitro and in vivo as either homo- or heterodimers which interact via their N-terminal domains and are subject to phosphorylation by protein kinase C. 14-3-3 proteins are localized in the cytoplasm of neurons in the cerebral cortex and are axonally transported to the nerve terminals. They may be present at lower levels in various other eukaryotic tissues. Northern blot analysis has shown expression of the eta chain in cultured cell lines derived from various tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: YWHAZ