ZSWIM7 Antibody

Images

 
Immunohistochemistry-Paraffin: ZSWIM7 Antibody [NBP2-30937] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZSWIM7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZSWIM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZSWIM7 Protein (NBP2-30937PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZSWIM7 Antibody

  • SWS1
  • ZSWIM7 zinc finger, SWIM-type containing 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00080303-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49180
Species: Hu
Applications: IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-30937
Species: Hu
Applications: IHC, IHC-P

Publications for ZSWIM7 Antibody (NBP2-30937) (0)

There are no publications for ZSWIM7 Antibody (NBP2-30937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZSWIM7 Antibody (NBP2-30937) (0)

There are no reviews for ZSWIM7 Antibody (NBP2-30937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZSWIM7 Antibody (NBP2-30937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZSWIM7 Products

ZSWIM7 NBP2-30937

Bioinformatics Tool for ZSWIM7 Antibody (NBP2-30937)

Discover related pathways, diseases and genes to ZSWIM7 Antibody (NBP2-30937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZSWIM7

There are no specific blogs for ZSWIM7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZSWIM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZSWIM7
Uniprot