ZRSR2 Antibody (2H5)

Images

 
Sandwich ELISA: ZRSR2 Antibody (2H5) [H00008233-M03] - Detection limit for recombinant GST tagged ZRSR2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZRSR2 Antibody (2H5) Summary

Immunogen
U2AF1L2 (NP_005080.1 294 a.a. - 393 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG
Specificity
U2AF1L2 - U2(RNU2) small nuclear RNA auxiliary factor 1-like 2 (2H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZRSR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZRSR2 Antibody (2H5)

  • CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2
  • Renal carcinoma antigen NY-REN-20
  • U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-relatedprotein 2
  • U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2
  • U2(RNU2) small nuclear RNA auxiliary factor 1-like 2MGC142014
  • U2AF1L2
  • U2AF1RS2MGC142040
  • U2AF1-RS2U2AF35-related protein
  • URPU2 small nuclear RNA auxiliary factor 1-like 2
  • zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2

Background

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80652
Species: Hu
Applications: IHC, IHC-P
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00199746-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00171023-M05
Species: Hu
Applications: WB, ELISA
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
9134-TN
Species: Hu
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00008233-M03
Species: Hu
Applications: ELISA

Publications for ZRSR2 Antibody (H00008233-M03) (0)

There are no publications for ZRSR2 Antibody (H00008233-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZRSR2 Antibody (H00008233-M03) (0)

There are no reviews for ZRSR2 Antibody (H00008233-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZRSR2 Antibody (H00008233-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZRSR2 Products

Bioinformatics Tool for ZRSR2 Antibody (H00008233-M03)

Discover related pathways, diseases and genes to ZRSR2 Antibody (H00008233-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZRSR2 Antibody (H00008233-M03)

Discover more about diseases related to ZRSR2 Antibody (H00008233-M03).
 

Pathways for ZRSR2 Antibody (H00008233-M03)

View related products by pathway.

Blogs on ZRSR2

There are no specific blogs for ZRSR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZRSR2 Antibody (2H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZRSR2
Entrez
Uniprot