Recombinant Human ZRANB2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZRANB2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-106 of Human ZNF265 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGF

Protein/Peptide Type
Partial Recombinant Protein
Gene
ZRANB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZRANB2 Protein

  • Oocyte-specific maternal effect factor
  • zygote arrest 1
  • zygote arrest protein 1

Background

ZNF265 - zinc finger protein 265

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
H00008227-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF5540
Species: Mu
Applications: WB
640-A3
Species: Mu
NBP2-58847
Species: Hu
Applications: WB, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for ZRANB2 Partial Recombinant Protein (H00009406-Q01) (0)

There are no publications for ZRANB2 Partial Recombinant Protein (H00009406-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZRANB2 Partial Recombinant Protein (H00009406-Q01) (0)

There are no reviews for ZRANB2 Partial Recombinant Protein (H00009406-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZRANB2 Partial Recombinant Protein (H00009406-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZRANB2 Products

Bioinformatics Tool for ZRANB2 Partial Recombinant Protein (H00009406-Q01)

Discover related pathways, diseases and genes to ZRANB2 Partial Recombinant Protein (H00009406-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZRANB2 Partial Recombinant Protein (H00009406-Q01)

Discover more about diseases related to ZRANB2 Partial Recombinant Protein (H00009406-Q01).
 

Pathways for ZRANB2 Partial Recombinant Protein (H00009406-Q01)

View related products by pathway.

PTMs for ZRANB2 Partial Recombinant Protein (H00009406-Q01)

Learn more about PTMs related to ZRANB2 Partial Recombinant Protein (H00009406-Q01).

Blogs on ZRANB2

There are no specific blogs for ZRANB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZRANB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZRANB2