ZnT-8/SLC30A8 Antibody - Azide and BSA Free

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZnT-8/SLC30A8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ZnT-8/SLC30A8 Antibody - Azide and BSA Free (NBP2-94810) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SLC30A8 (NP_776250.2). MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYAKWKLC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC30A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ZnT-8/SLC30A8 Antibody - Azide and BSA Free

• SLC30A8
• solute carrier family 30 (zinc transporter), member 8
• Solute carrier family 30 member 8
• zinc transporter 8
• zinc transporter ZnT-8
• ZnT8
• ZnT-8
• ZNT8ZnT-8

Background

Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellularsignal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such asSLC30A8, permit cellular efflux of zinc (Seve et al., 2004 (PubMed 15154973)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC30A8