ZnT-8/SLC30A8 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZnT-8/SLC30A8 Antibody [NBP2-62701] - Staining of human pancreas shows high expression.

Immunohistochemistry-Paraffin: ZnT-8/SLC30A8 Antibody [NBP2-62701] - Analysis in human pancreas and liver tissues using Anti-SLC30A8 antibody. Corresponding SLC30A8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ZnT-8/SLC30A8 Antibody [NBP2-62701] - Staining of human liver shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZnT-8/SLC30A8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC30A8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZnT-8/SLC30A8 Recombinant Protein Antigen (NBP2-62701PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ZnT-8/SLC30A8 Antibody - BSA Free

• SLC30A8
• solute carrier family 30 (zinc transporter), member 8
• Solute carrier family 30 member 8
• zinc transporter 8
• zinc transporter ZnT-8
• ZnT8
• ZnT-8
• ZNT8ZnT-8

Background

Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellularsignal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such asSLC30A8, permit cellular efflux of zinc (Seve et al., 2004 (PubMed 15154973)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC30A8