Recombinant Human ZNF81 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF81 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 122 of Human ZNF81 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTLC

Protein/Peptide Type
Recombinant Protein
Gene
ZNF81

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF81 Protein

  • dJ54B20.6
  • FLJ44367
  • HFZ20X-linked 45
  • zinc finger protein 81 (HFZ20)
  • zinc finger protein 81

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13412
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ZNF81 Recombinant Protein (H00347344-P01) (0)

There are no publications for ZNF81 Recombinant Protein (H00347344-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF81 Recombinant Protein (H00347344-P01) (0)

There are no reviews for ZNF81 Recombinant Protein (H00347344-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF81 Recombinant Protein (H00347344-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF81 Products

Bioinformatics Tool for ZNF81 Recombinant Protein (H00347344-P01)

Discover related pathways, diseases and genes to ZNF81 Recombinant Protein (H00347344-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF81 Recombinant Protein (H00347344-P01)

Discover more about diseases related to ZNF81 Recombinant Protein (H00347344-P01).
 

Pathways for ZNF81 Recombinant Protein (H00347344-P01)

View related products by pathway.

Blogs on ZNF81

There are no specific blogs for ZNF81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Synapsin I Antibody
NB300-104-100ul
ZNF81 Antibody
NBP1-79990
ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF81 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF81