ZNF655 Antibody

Images

 
Western Blot: ZNF655 Antibody [NBP2-88719] - WB Suggested Anti-ZNF655 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: COLO205 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF655 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF655. Peptide sequence: QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF655
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF655 Antibody

  • zinc finger protein 655

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-30888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-67909
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
H00000514-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005212-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-88719
Species: Hu
Applications: WB

Publications for ZNF655 Antibody (NBP2-88719) (0)

There are no publications for ZNF655 Antibody (NBP2-88719).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF655 Antibody (NBP2-88719) (0)

There are no reviews for ZNF655 Antibody (NBP2-88719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF655 Antibody (NBP2-88719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF655 Products

Bioinformatics Tool for ZNF655 Antibody (NBP2-88719)

Discover related pathways, diseases and genes to ZNF655 Antibody (NBP2-88719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZNF655 Antibody (NBP2-88719)

View related products by pathway.

Blogs on ZNF655

There are no specific blogs for ZNF655, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF655 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF655