ZNF540 Antibody

Images

 
Western Blot: ZNF540 Antibody [NBP2-83867] - WB Suggested Anti-ZNF540 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: MCF7 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF540 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF540. Peptide sequence: CGKAFRLNSHLTEHQRIHTGEKPYECKVCRKAFRQYSHLYQHQKTHNVI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF540
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF540 Antibody

  • DKFZp313K2238
  • DKFZp547B0714
  • FLJ16004
  • Nbla10512
  • putative protein product of Nbla10512
  • zinc finger protein 540

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00007710-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-90646
Species: Hu
Applications: IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59214
Species: Hu
Applications: WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB200-142
Species: Hu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NBP1-92641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-37254
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-56951
Species: Hu
Applications: WB
5036-WN
Species: Hu
Applications: BA, BA
AF6539
Species: Hu
Applications: IHC, WB
H00084504-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-92394
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-95244
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31842
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83867
Species: Hu
Applications: WB

Publications for ZNF540 Antibody (NBP2-83867) (0)

There are no publications for ZNF540 Antibody (NBP2-83867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF540 Antibody (NBP2-83867) (0)

There are no reviews for ZNF540 Antibody (NBP2-83867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF540 Antibody (NBP2-83867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF540 Products

Bioinformatics Tool for ZNF540 Antibody (NBP2-83867)

Discover related pathways, diseases and genes to ZNF540 Antibody (NBP2-83867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF540 Antibody (NBP2-83867)

Discover more about diseases related to ZNF540 Antibody (NBP2-83867).
 

Pathways for ZNF540 Antibody (NBP2-83867)

View related products by pathway.

PTMs for ZNF540 Antibody (NBP2-83867)

Learn more about PTMs related to ZNF540 Antibody (NBP2-83867).

Blogs on ZNF540

There are no specific blogs for ZNF540, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF540 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF540