ZNF433 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 564-673 of human ZNF433 (NP_001073880.1). CKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFGCASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQLQVHGRAHCIDTP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZNF433 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for ZNF433 Antibody - Azide and BSA Free
Background
ZNF433 may be involved in transcriptional regulation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
Species: Ca, Hu, Pm
Applications: WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for ZNF433 Antibody (NBP3-05110) (0)
There are no publications for ZNF433 Antibody (NBP3-05110).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF433 Antibody (NBP3-05110) (0)
There are no reviews for ZNF433 Antibody (NBP3-05110).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF433 Antibody (NBP3-05110) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF433 Products
Blogs on ZNF433