ZNF433 Antibody - Azide and BSA Free

Western Blot: ZNF433 Antibody [NBP3-05110] - Paraffin-embedded rat brain using ZNF433 antibody at dilution of 1:100 (40x lens).

Immunocytochemistry/Immunofluorescence: ZNF433 Antibody [NBP3-05110] - Immunofluorescence analysis of U-2 OS cells using ZNF433 Polyclonal Antibody (NBP3-05110) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: ZNF433 Antibody [NBP3-05110] - Immunohistochemistry of paraffin-embedded human gastric cancer using ZNF433 antibody (NBP3-05110) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: ZNF433 Antibody [NBP3-05110] - Immunofluorescence analysis of C6 cells using ZNF433 Polyclonal Antibody (NBP3-05110) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: ZNF433 Antibody [NBP3-05110] - Immunofluorescence analysis of NIH-3T3 cells using ZNF433 Polyclonal Antibody (NBP3-05110) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: ZNF433 Antibody [NBP3-05110] - Immunohistochemistry of paraffin-embedded mouse kidney using ZNF433 antibody (NBP3-05110) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF433 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 564-673 of human ZNF433 (NP_001073880.1). CKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFGCASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQLQVHGRAHCIDTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF433
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ZNF433 Antibody - Azide and BSA Free

• FLJ38685
• FLJ77809
• MGC45417
• zfp-276
• ZFP276MGC126480
• zinc finger protein 276 homolog (mouse)
• zinc finger protein 276 homolog
• zinc finger protein 276
• Zinc finger protein 477
• ZNF477MGC111410

Background

ZNF433 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ZNF433