ZNF433 Antibody

Images

 
Western Blot: ZNF433 Antibody [NBP1-79369] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF433 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF433The immunogen for this antibody is ZNF433. Peptide sequence GEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF433
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF433 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF433 Antibody

  • FLJ38685
  • FLJ77809
  • MGC45417
  • zfp-276
  • ZFP276MGC126480
  • zinc finger protein 276 homolog (mouse)
  • zinc finger protein 276 homolog
  • zinc finger protein 276
  • Zinc finger protein 477
  • ZNF477MGC111410

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58984
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-67623
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24606
Species: Hu, Mu
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for ZNF433 Antibody (NBP1-79369) (0)

There are no publications for ZNF433 Antibody (NBP1-79369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF433 Antibody (NBP1-79369) (0)

There are no reviews for ZNF433 Antibody (NBP1-79369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF433 Antibody (NBP1-79369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF433 Antibody (NBP1-79369)

Discover related pathways, diseases and genes to ZNF433 Antibody (NBP1-79369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF433 Antibody (NBP1-79369)

Discover more about diseases related to ZNF433 Antibody (NBP1-79369).
 

Pathways for ZNF433 Antibody (NBP1-79369)

View related products by pathway.

Blogs on ZNF433

There are no specific blogs for ZNF433, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF433 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF433
Uniprot