We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZNF274 Recombinant Protein Antigen

Images

 
There are currently no images for ZNF274 Protein (NBP1-80597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNF274 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF274.

Source: E. coli

Amino Acid Sequence: FGHLVSVGWETTLENKELAPNSDIPEEEPAPSLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF274
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80597.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNF274 Recombinant Protein Antigen

  • GIOT2
  • GIOT-2
  • gonadotropin inducible transcription repressor-2
  • Gonadotropin-inducible ovary transcription repressor 2
  • gonadotropin-inducible transcription repressor 2
  • KOX7DKFZp434F1811
  • zinc finger protein 44 (KOX 7)
  • zinc finger protein 44
  • Zinc finger protein 55DKFZp686L21136
  • Zinc finger protein 58ZNF504
  • Zinc finger protein KOX7
  • zinc finger protein ZnFP12
  • ZNF
  • ZNF55
  • ZNF58

Background

ZNF274 encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94859
Species: Hu, Mu, Rt
Applications: WB
NBP2-30747
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF2128
Species: Mu
Applications: IHC, WB
NBP1-79451
Species: Hu
Applications: WB
H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2350
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP1-82455
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-97766
Species: Hu
Applications: PEP-ELISA, WB
NBP2-83654
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB

Publications for ZNF274 Protein (NBP1-80597PEP) (0)

There are no publications for ZNF274 Protein (NBP1-80597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF274 Protein (NBP1-80597PEP) (0)

There are no reviews for ZNF274 Protein (NBP1-80597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZNF274 Protein (NBP1-80597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF274 Products

Blogs on ZNF274

There are no specific blogs for ZNF274, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF274 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF274