Recombinant Human ZNF274 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF274 Protein Summary

Description
ZNF274 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF274

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF274 Protein

  • GIOT2
  • GIOT-2
  • gonadotropin inducible transcription repressor-2
  • Gonadotropin-inducible ovary transcription repressor 2
  • gonadotropin-inducible transcription repressor 2
  • KOX7DKFZp434F1811
  • zinc finger protein 44 (KOX 7)
  • zinc finger protein 44
  • Zinc finger protein 55DKFZp686L21136
  • Zinc finger protein 58ZNF504
  • Zinc finger protein KOX7
  • zinc finger protein ZnFP12
  • ZNF
  • ZNF55
  • ZNF58

Background

ZNF274 - zinc finger protein 274

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7506
Species: Hu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-79451
Species: Hu
Applications: WB
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF2818
Species: Hu
Applications: WB, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3077
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ZNF274 Partial Recombinant Protein (H00010782-Q01) (0)

There are no publications for ZNF274 Partial Recombinant Protein (H00010782-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF274 Partial Recombinant Protein (H00010782-Q01) (0)

There are no reviews for ZNF274 Partial Recombinant Protein (H00010782-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF274 Partial Recombinant Protein (H00010782-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human ZNF274 Protein Products

Related Products by Gene

Bioinformatics Tool for ZNF274 Partial Recombinant Protein (H00010782-Q01)

Discover related pathways, diseases and genes to ZNF274 Partial Recombinant Protein (H00010782-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF274 Partial Recombinant Protein (H00010782-Q01)

Discover more about diseases related to ZNF274 Partial Recombinant Protein (H00010782-Q01).
 

Pathways for ZNF274 Partial Recombinant Protein (H00010782-Q01)

View related products by pathway.

Blogs on ZNF274

There are no specific blogs for ZNF274, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human ZNF274 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF274

Customers Who Bought This Also Bought

ZNF274 Antibody
NBP1-80597
ZNF274 Antibody
NBP1-80597
ZNF274 Antibody
NBP1-80597