ZNF266 Antibody

Images

 
Western Blot: ZNF266 Antibody [H00010781-D01P] - Analysis of ZNF266 expression in transfected 293T cell line by ZNF266 polyclonal antibody.Lane 1: ZNF266 transfected lysate(29.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF266 Antibody Summary

Immunogen
ZNF266 (AAH17407.1, 1 a.a. - 263 a.a.) full-length human protein. MKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIKPYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAISSNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEKPYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA
Specificity
Reacts with zinc finger protein 266.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF266
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF266 Antibody

  • KOX5BRC1744
  • Zinc finger protein 13Zinc finger protein KOX5
  • zinc finger protein 45 (a Kruppel-associated box (KRAB) domain polypeptide)
  • zinc finger protein 45
  • ZNF13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74624
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-81343
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-94769
Species: Rt
Applications: WB, IHC
AF3760
Species: Hu
Applications: WB
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NBP2-45816
Species: Hu
Applications: WB, Flow, IHC
NBP2-81930
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
NB100-1761
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ZNF266 Antibody (H00010781-D01P) (0)

There are no publications for ZNF266 Antibody (H00010781-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF266 Antibody (H00010781-D01P) (0)

There are no reviews for ZNF266 Antibody (H00010781-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF266 Antibody (H00010781-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF266 Products

Bioinformatics Tool for ZNF266 Antibody (H00010781-D01P)

Discover related pathways, diseases and genes to ZNF266 Antibody (H00010781-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF266 Antibody (H00010781-D01P)

Discover more about diseases related to ZNF266 Antibody (H00010781-D01P).
 

Pathways for ZNF266 Antibody (H00010781-D01P)

View related products by pathway.

Blogs on ZNF266

There are no specific blogs for ZNF266, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF266 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF266
Entrez
Uniprot