Home » ZNF266 » ZNF266 Antibodies » ZNF266 Antibody

ZNF266 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF266 Antibody [H00010781-D01P] - Analysis of ZNF266 expression in transfected 293T cell line by ZNF266 polyclonal antibody.Lane 1: ZNF266 transfected lysate(29.90 KDa).Lane 2: Non-transfected lysate.
Western Blot: ZNF266 Antibody [H00010781-D01P] - Analysis of ZNF266 expression in transfected 293T cell line by ZNF266 polyclonal antibody.Lane 1: ZNF266 transfected lysate(29.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF266 Antibody Summary

Immunogen
ZNF266 (AAH17407.1, 1 a.a. - 263 a.a.) full-length human protein. MKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIKPYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAISSNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEKPYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA
Specificity
Reacts with zinc finger protein 266.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF266
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF266 Antibody

  • KOX5BRC1744
  • Zinc finger protein 13Zinc finger protein KOX5
  • zinc finger protein 45 (a Kruppel-associated box (KRAB) domain polypeptide)
  • zinc finger protein 45
  • ZNF13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CIZ1 Antibody
NB100-74624
Western Blot: CIZ1 Antibody [NB100-74624] - Detection of Human CIZ1on HeLa whole cell lysate using NB100-74624. CIZ1 was also immunoprecipitated by rabbit anti-CIZ1 antibody NB100-74623.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IP
MEF2A Antibody
(JA33-04)
NBP2-66943
Western Blot: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of MEF2A on rat spleen tissue lysate using anti-MEF2A antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded mouse spleen tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded human spleen tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CDK2 Antibody
(OTI2D9)
NBP2-00776
Western Blot: Cdk2 Antibody (2D9) [NBP2-00776] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cdk2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cdk2.
Immunohistochemistry-Paraffin: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-Cdk2 mouse monoclonal antibody.
(1 Review)
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NRAMP1/SLC11A1
Antibody (910825)
MAB8400
Western blot shows lysates of HEK293 human embryonic kidney cell line either mock transfected or transfected with human NRAMP1/SLC11A1. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human NRAMP1/SLC11A1 Monoclonal Antibody (Catalog # MAB8400) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for NRAMP1/SLC11A1 at approximately 90-120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HEK293 human embryonic kidney cell line transfected with either (A) human NRAMP1/SLC11A1 or (B) irrelevant transfectants and eGFP was stained with Mouse Anti-Human NRAMP1/SLC11A1 Monoclonal Antibody (Catalog # MAB8400) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). Quadrant markers were set based on control antibody staining (Catalog # MAB0041).
Species: Hu
Applications: WB, Flow, CyTOF-ready
ZNF16 Antibody
NBP1-81343
Western Blot: ZNF16 Antibody [NBP1-81343] - Analysis in control (vector only transfected HEK293T lysate) and ZNF16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ZNF16 Antibody [NBP1-81343] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in glomeruli.
Species: Hu
Applications: WB, IHC, IHC-P
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
RIZ1 Antibody
NBP2-94769
Western Blot: RIZ1 Antibody [NBP2-94769] - Analysis of extracts of rat heart, using RIZ1.Exposure time: 90s.
Immunohistochemistry-Paraffin: RIZ1 Antibody [NBP2-94769] - Paraffin-embedded rat testis using RIZ1.
Western Blot: RIZ1 Antibody [NBP2-94769] - Paraffin-embedded rat lung using RIZ1.
Species: Rt
Applications: WB, IHC
Miz-1/ZBTB17
Antibody
AF3760
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and CEM human T-lymphoblastoid cell line. PVDF membrane was probed with 1 µg/mL of Human Miz‑1/ZBTB17 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3760) followed by HRP‑conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Miz-1/ZBTB17 at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(48 Publications)
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
TPT1/TCTP Antibody
(JU13-32)
NBP2-75686
Western Blot: TPT1/TCTP Antibody (JU13-32) [NBP2-75686] - Analysis of TCTP on different lysates using anti-TCTP antibody at 1/1,000 dilution.Positive control:Lane 1: Mouse placenta tissue Lane 2: Mouse testis tissueLane 3: Hela Lane 4: A431 Lane 5: MCF-7
Immunocytochemistry/Immunofluorescence: TPT1/TCTP Antibody (JU13-32) [NBP2-75686] - Staining TCTP in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: TPT1/TCTP Antibody (JU13-32) [NBP2-75686] - Analysis of paraffin-embedded mouse testis tissue using anti-TCTP antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SLC12A9 Antibody
NBP2-68858
Immunohistochemistry-Paraffin: SLC12A9 Antibody [NBP2-68858] - Staining of human small intestine shows strong positivity in subsets of immune cells.
Species: Hu
Applications: IHC, IHC-P
MKRN1 Antibody
(OTI2C8)
NBP2-45816
Western Blot: MKRN1 Antibody (OTI2C8) [NBP2-45816] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MKRN1.
Immunohistochemistry: MKRN1 Antibody (OTI2C8) [NBP2-45816] - Analysis of Carcinoma of Human bladder tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Flow Cytometry: MKRN1 Antibody (OTI2C8) [NBP2-45816] - Analysis of Jurkat cells, using anti-MKRN1 antibody, (Red), compared to a nonspecific negative control antibody, (Blue).
Species: Hu
Applications: WB, Flow, IHC
PLAGL2 Antibody
NBP2-81930
Western Blot: PLAGL2 Antibody [NBP2-81930] - Analysis of PLAGL2 in rat brain tissue lysate with PLAGL2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: PLAGL2 Antibody [NBP2-81930] - Analysis of PLAGL2 in rat brain tissue with PLAGL2 antibody at 20 ug/ml. Green: PLAGL2 antibody [NBP2-81930]. Blue: DAPI staining.
Immunohistochemistry: PLAGL2 Antibody [NBP2-81930] - Analysis of PLAGL2 in rat brain tissue with PLAGL2 antibody at 2 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
RNF13 Antibody
NBP1-31251
Western Blot: RNF13 Antibody [NBP1-31251] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RNF13 Antibody [NBP1-31251] - Paraformaldehyde-fixed MCF-7, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RNF13 Antibody [NBP1-31251] - Paraffin-embedded A549 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Ctip1 Antibody
NB600-261
Western Blot: Ctip1 Antibody [NB600-261] - Whole cell lysate (50 ug) from L1210, TCMK-1, and 4T1 cells. Antibodies: Affinity purified rabbit anti-Bcl11a antibody used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: Ctip1 Antibody [NB600-261] - Detection of human Ctip1 (Bcl11a) by western blot. Samples: Whole cell lysate from Ramos (15 and 50 ug), HEK293T (T; 50 ug) and Jurkat (J; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Ctip1 antibody NB600-261 used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds.
Immunoprecipitation: Ctip1 Antibody [NB600-261] - Detection of human Ctip1 (Bcl11a) by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from Ramos cells. Antibodies: Affinity purified rabbit anti-Ctip1 antibody NB600-261 used for IP at 6 ul/mg lysate. Ctip1 was also immunoprecipitated by a rabbit anti-Ctip1 antibodies (NB600-258, NB600-259) and rabbit anti-Ctip1 recombinant monoclonal antibody [BLR073G] (NBP2-78710). For blotting immunoprecipitated Ctip1, NBP2-78710 was used at 1:1000. Chemiluminescence with an exposure time of 75 seconds.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
Matrin 3 Antibody
NB100-1761
Immunoprecipitation: Matrin 3 Antibody [NB100-1761] - Detection of Human and Mouse Matrin 3 on HeLa whole cell lysate using NB100-1761. Matrin 3 was also immunoprecipitated using another rabbit anti-Matrin 3 antibody and NB100-1559.
Immunohistochemistry: Matrin 3 Antibody [NB100-1761] - Sample: FFPE section of human stomach carcinoma. Antibody: Affinity purified rabbit anti-Matrin 3 used at a dilution of 1:400 (0.5ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated
Immunohistochemistry-Paraffin: Matrin 3 Antibody [NB100-1761] - Section of human laryengeal squamous cell carcinoma (left) and mouse squamous cell carcinoma (right). Antibody: Affinity purified rabbit anti- Matrin 3 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ZNF266 Antibody (H00010781-D01P) (0)

There are no publications for ZNF266 Antibody (H00010781-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF266 Antibody (H00010781-D01P) (0)

There are no reviews for ZNF266 Antibody (H00010781-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF266 Antibody (H00010781-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ZNF266 Products

Bioinformatics Tool for ZNF266 Antibody (H00010781-D01P)

Discover related pathways, diseases and genes to ZNF266 Antibody (H00010781-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF266 Antibody (H00010781-D01P)

Discover more about diseases related to ZNF266 Antibody (H00010781-D01P).
 

Pathways for ZNF266 Antibody (H00010781-D01P)

View related products by pathway.

Blogs on ZNF266

There are no specific blogs for ZNF266, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF266 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF266
Entrez
Uniprot