ZNF197 Antibody

Images

 
Western Blot: ZNF197 Antibody [NBP2-86449] - WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF197 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF197. Peptide sequence: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF197
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF197 Antibody

  • D3S1363E
  • P18
  • VHL-associated KRAB-A domain-containing protein
  • zinc finger protein 166
  • zinc finger protein 197
  • zinc finger protein 20
  • Zinc finger protein with KRAB and SCAN domains 9
  • ZKSCAN9VHLaK
  • ZNF166
  • ZNF20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB120-3216
Species: Hu, Mu
Applications: IF, IHC, IHC-P, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-74359
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
AF1555
Species: Hu
Applications: WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
1887-ML/CF
Species: Mu
Applications: BA
AF4937
Species: Hu
Applications: IHC, WB

Publications for ZNF197 Antibody (NBP2-86449) (0)

There are no publications for ZNF197 Antibody (NBP2-86449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF197 Antibody (NBP2-86449) (0)

There are no reviews for ZNF197 Antibody (NBP2-86449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF197 Antibody (NBP2-86449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF197 Products

Bioinformatics Tool for ZNF197 Antibody (NBP2-86449)

Discover related pathways, diseases and genes to ZNF197 Antibody (NBP2-86449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF197 Antibody (NBP2-86449)

Discover more about diseases related to ZNF197 Antibody (NBP2-86449).

Blogs on ZNF197

There are no specific blogs for ZNF197, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF197 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF197