ZNF185 Recombinant Protein Antigen

Images

 
There are currently no images for ZNF185 Protein (NBP1-86192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZNF185 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF185.

Source: E.coli

Amino Acid Sequence: PADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIPAPASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGST

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF185
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86192.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZNF185 Recombinant Protein Antigen

  • zinc finger protein 185 (LIM domain)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3850
Species: Hu
Applications: WB
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
AF1668
Species: Hu
Applications: WB, IP
NBP1-86192PEP
Species: Hu
Applications: AC

Publications for ZNF185 Protein (NBP1-86192PEP) (0)

There are no publications for ZNF185 Protein (NBP1-86192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF185 Protein (NBP1-86192PEP) (0)

There are no reviews for ZNF185 Protein (NBP1-86192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ZNF185 Protein (NBP1-86192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF185 Products

Bioinformatics Tool for ZNF185 Protein (NBP1-86192PEP)

Discover related pathways, diseases and genes to ZNF185 Protein (NBP1-86192PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF185 Protein (NBP1-86192PEP)

Discover more about diseases related to ZNF185 Protein (NBP1-86192PEP).
 

Pathways for ZNF185 Protein (NBP1-86192PEP)

View related products by pathway.

PTMs for ZNF185 Protein (NBP1-86192PEP)

Learn more about PTMs related to ZNF185 Protein (NBP1-86192PEP).

Blogs on ZNF185

There are no specific blogs for ZNF185, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Brg1 Antibody
NB100-2594
Brg1 Antibody
NB100-2594
Brg1 Antibody
NB100-2594
ZNF185 Antibody
NBP1-86452
ZNF185 Antibody
NBP1-86452

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZNF185 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF185