Recombinant Human ZNF175 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF175 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 81-178 of Human ZNF175 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRLDADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF175

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF175 Protein

  • OTK18Zinc finger protein OTK18
  • zinc finger protein 175

Background

ZNF175 - zinc finger protein 175

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81018
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2819
Species: Hu
Applications: WB, ICC
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
H00007728-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF175 Partial Recombinant Protein (H00007728-Q01) (0)

There are no publications for ZNF175 Partial Recombinant Protein (H00007728-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF175 Partial Recombinant Protein (H00007728-Q01) (0)

There are no reviews for ZNF175 Partial Recombinant Protein (H00007728-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF175 Partial Recombinant Protein (H00007728-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF175 Products

Bioinformatics Tool for ZNF175 Partial Recombinant Protein (H00007728-Q01)

Discover related pathways, diseases and genes to ZNF175 Partial Recombinant Protein (H00007728-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF175 Partial Recombinant Protein (H00007728-Q01)

Discover more about diseases related to ZNF175 Partial Recombinant Protein (H00007728-Q01).
 

Pathways for ZNF175 Partial Recombinant Protein (H00007728-Q01)

View related products by pathway.

PTMs for ZNF175 Partial Recombinant Protein (H00007728-Q01)

Learn more about PTMs related to ZNF175 Partial Recombinant Protein (H00007728-Q01).

Blogs on ZNF175

There are no specific blogs for ZNF175, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF175 Antibody
NBP1-80969
GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF175 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF175