Recombinant Human ZNF174 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF174 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-234 of Human ZNF174 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZNF174
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF174 Protein

  • AW-1
  • zinc finger protein 174
  • ZSCAN8Zinc finger and SCAN domain-containing protein 8

Background

ZNF174( AAH00876, 1 a.a. - 235 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56092
Species: Hu
Applications: WB, ICC/IF
NBP2-38425
Species: Hu
Applications: IHC, IHC-P
NBP1-76669
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-82605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-82840
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-20970
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007727-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF174 Recombinant Protein (H00007727-P01) (0)

There are no publications for ZNF174 Recombinant Protein (H00007727-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF174 Recombinant Protein (H00007727-P01) (0)

There are no reviews for ZNF174 Recombinant Protein (H00007727-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF174 Recombinant Protein (H00007727-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF174 Products

Bioinformatics Tool for ZNF174 Recombinant Protein (H00007727-P01)

Discover related pathways, diseases and genes to ZNF174 Recombinant Protein (H00007727-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF174 Recombinant Protein (H00007727-P01)

Discover more about diseases related to ZNF174 Recombinant Protein (H00007727-P01).
 

Pathways for ZNF174 Recombinant Protein (H00007727-P01)

View related products by pathway.

PTMs for ZNF174 Recombinant Protein (H00007727-P01)

Learn more about PTMs related to ZNF174 Recombinant Protein (H00007727-P01).

Blogs on ZNF174

There are no specific blogs for ZNF174, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZNF174 Antibody
NBP1-86821

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF174 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF174