ZNF16 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF16. Peptide sequence: GKAFSQRSVLIQHQRIHTGVKPYDCAACGKAFSQRSKLIKHQLIHTRE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZNF16 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ZNF16 Antibody - BSA Free
Background
ZNF16 is encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, Flow, GS, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for ZNF16 Antibody (NBP2-86441) (0)
There are no publications for ZNF16 Antibody (NBP2-86441).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF16 Antibody (NBP2-86441) (0)
There are no reviews for ZNF16 Antibody (NBP2-86441).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF16 Antibody (NBP2-86441) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF16 Products
Blogs on ZNF16