ZNF155 Antibody (2F11)

Images

 
Sandwich ELISA: ZNF155 Antibody (2F11) [H00007711-M01] - Detection limit for recombinant GST tagged ZNF155 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF155 Antibody (2F11) Summary

Immunogen
ZNF155 (NP_003436 422 a.a. - 520 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRR
Specificity
ZNF155 - zinc finger protein 155 (pHZ-96)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF155
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF155 Antibody (2F11)

  • KRAB A domain
  • MGC161655
  • pHZ-96
  • zinc finger protein 155 (pHZ-96)
  • zinc finger protein 155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-81633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00094039-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00009910-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-79358
Species: Hu
Applications: WB
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-470
Species: Ye
Applications: WB, ELISA
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF155 Antibody (H00007711-M01) (0)

There are no publications for ZNF155 Antibody (H00007711-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF155 Antibody (H00007711-M01) (0)

There are no reviews for ZNF155 Antibody (H00007711-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF155 Antibody (H00007711-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF155 Products

Bioinformatics Tool for ZNF155 Antibody (H00007711-M01)

Discover related pathways, diseases and genes to ZNF155 Antibody (H00007711-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF155

There are no specific blogs for ZNF155, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF155 Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF155
Entrez
OMIM
Uniprot