ZNF154 Antibody

Images

 
Western Blot: ZNF154 Antibody [NBP1-79273] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF154 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF154The immunogen for this antibody is ZNF154. Peptide sequence QRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF154
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF154 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF154 Antibody

  • KIAA2003
  • MGC176628
  • MGC176661
  • pHZ-92
  • zinc finger protein 154

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-90646
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-56958
Species: Hu
Applications: ICC/IF
NB200-142
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-86699
Species: Hu
Applications: IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84170
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6539
Species: Hu
Applications: WB, IHC
NBP1-79273
Species: Hu
Applications: WB

Publications for ZNF154 Antibody (NBP1-79273) (0)

There are no publications for ZNF154 Antibody (NBP1-79273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF154 Antibody (NBP1-79273) (0)

There are no reviews for ZNF154 Antibody (NBP1-79273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF154 Antibody (NBP1-79273). (Showing 1 - 1 of 1 FAQ).

  1. Could you tell me the sequence of your immunogen of the ZNF154 antibody NBP1-79273?
    • The immunogen sequence for NBP1-79273 is QRCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHV

Secondary Antibodies

 

Isotype Controls

Additional ZNF154 Products

Bioinformatics Tool for ZNF154 Antibody (NBP1-79273)

Discover related pathways, diseases and genes to ZNF154 Antibody (NBP1-79273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF154 Antibody (NBP1-79273)

Discover more about diseases related to ZNF154 Antibody (NBP1-79273).
 

Pathways for ZNF154 Antibody (NBP1-79273)

View related products by pathway.

PTMs for ZNF154 Antibody (NBP1-79273)

Learn more about PTMs related to ZNF154 Antibody (NBP1-79273).

Blogs on ZNF154

There are no specific blogs for ZNF154, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF154 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF154
Uniprot