ZMPSTE24 Antibody


Western Blot: ZMPSTE24 Antibody [NBP1-84755] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: ZMPSTE24 Antibody [NBP1-84755] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ZMPSTE24 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
Specificity of human ZMPSTE24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
ZMPSTE24 Lysate (NBP2-65335)
Control Peptide
ZMPSTE24 Protein (NBP1-84755PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZMPSTE24 Antibody

  • zona pellucida binding protein 2
  • zona pellucida-binding protein 2
  • ZPBP-like protein
  • ZPBPLMGC41930


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for ZMPSTE24 Antibody (NBP1-84755) (0)

There are no publications for ZMPSTE24 Antibody (NBP1-84755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMPSTE24 Antibody (NBP1-84755) (0)

There are no reviews for ZMPSTE24 Antibody (NBP1-84755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMPSTE24 Antibody (NBP1-84755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ZMPSTE24 Products

Bioinformatics Tool for ZMPSTE24 Antibody (NBP1-84755)

Discover related pathways, diseases and genes to ZMPSTE24 Antibody (NBP1-84755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZMPSTE24 Antibody (NBP1-84755)

Discover more about diseases related to ZMPSTE24 Antibody (NBP1-84755).

Pathways for ZMPSTE24 Antibody (NBP1-84755)

View related products by pathway.

PTMs for ZMPSTE24 Antibody (NBP1-84755)

Learn more about PTMs related to ZMPSTE24 Antibody (NBP1-84755).

Research Areas for ZMPSTE24 Antibody (NBP1-84755)

Find related products by research area.

Blogs on ZMPSTE24.

ZMPSTE24 Mutations, Lamin A Processing & Laminopathies
ZMPSTE24 (FACE-1, CAAX prenyl protease 1 homolog) is a membrane associated zinc metalloprotease of the peptidase M48A family. It's catalytic activity can be defined as the peptide bond hydrolyzed in the sequence -C-|-A-A-X in which C is an S-isoprenyl...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZMPSTE24 Antibody and receive a gift card or discount.


Gene Symbol ZMPSTE24