ZMPSTE24 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZMPSTE24 Antibody [NBP1-84755] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZMPSTE24 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZMPSTE24 Antibody - BSA Free (NBP1-84755) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZMPSTE24
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZMPSTE24 Protein (NBP1-84755PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZMPSTE24 Antibody - BSA Free

• zona pellucida binding protein 2
• zona pellucida-binding protein 2
• ZPBP-like protein
• ZPBPLMGC41930

Background

ZMPSTE24, also known as FACE1, is a zinc metalloprotease involved in the post-translational processing of Lamin A/C precursors. Specifically, ZMPSTE-24 proteolytically removes the C-terminal three residues of the farnesylated Lamin proteins.

FACE-1 is widely expressed, with the highest levels found in the kidney, prostate, testis and ovary.

Mutations in ZMPSTE24 have been associated with human diseases such as mandibuloacral dysplasia with type B lipodystrophy (MADB) and lethal tight skin contracture syndrome (LTSCS), often due to the accumulation of LMNA precursors. It is theorized that ZMPSTE24 may play an important role in human ageing, based on its association with LMNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZMPSTE24