Zinc finger protein 639 Antibody

Images

 
Immunohistochemistry-Paraffin: Zinc finger protein 639 Antibody [NBP2-49035] - Staining of human testis shows cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zinc finger protein 639 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:KRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF639
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Zinc finger protein 639 Recombinant Protein Antigen (NBP2-49035PEP)

Reactivity Notes

Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zinc finger protein 639 Antibody

  • ANC_2H01
  • ZASC1ANC-2H01
  • zinc finger amplified in esophageal squamous cell carcinomas 1
  • zinc finger protein 639
  • Zinc finger protein ANC_2H01
  • Zinc finger protein ZASC1,6230400O18Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001496-B01P
Species: Hu, Rt
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-84891
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-46403
Species: Hu
Applications: IHC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Zinc finger protein 639 Antibody (NBP2-49035) (0)

There are no publications for Zinc finger protein 639 Antibody (NBP2-49035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc finger protein 639 Antibody (NBP2-49035) (0)

There are no reviews for Zinc finger protein 639 Antibody (NBP2-49035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Zinc finger protein 639 Antibody (NBP2-49035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zinc finger protein 639 Products

Bioinformatics Tool for Zinc finger protein 639 Antibody (NBP2-49035)

Discover related pathways, diseases and genes to Zinc finger protein 639 Antibody (NBP2-49035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zinc finger protein 639 Antibody (NBP2-49035)

Discover more about diseases related to Zinc finger protein 639 Antibody (NBP2-49035).
 

Pathways for Zinc finger protein 639 Antibody (NBP2-49035)

View related products by pathway.

Blogs on Zinc finger protein 639

There are no specific blogs for Zinc finger protein 639, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zinc finger protein 639 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF639